PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00047g01824.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 431aa    MW: 48149.3 Da    PI: 6.1508
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00047g01824.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-162774148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g+WT+ Ed +l ++vk++G g+W+++ r  g+ R++k+c++rw ++l
  Peaxi162Scf00047g01824.1 27 KGPWTAAEDAILMEYVKKHGEGNWNAVQRNSGLMRCGKSCRLRWANHL 74
                              79******************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.0322278IPR017930Myb domain
SMARTSM007173.0E-132676IPR001005SANT/Myb domain
PfamPF002491.2E-142774IPR001005SANT/Myb domain
SuperFamilySSF466893.47E-2428103IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-232881IPR009057Homeodomain-like
CDDcd001673.19E-112974No hitNo description
PROSITE profilePS512948.95179119IPR017930Myb domain
SMARTSM007170.02979117IPR001005SANT/Myb domain
CDDcd001670.0012682115No hitNo description
Gene3DG3DSA:1.10.10.604.9E-1082118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MAPNGGGVKT SLARNISHGG TRHVLKKGPW TAAEDAILME YVKKHGEGNW NAVQRNSGLM  60
RCGKSCRLRW ANHLRPNLKK GAFSLEEERL IVELHAKLGN KWAHNEIKNY WNTRLKRRQR  120
AGLPIYPQDI QPQNQHEHNI SSLFDHPQNS NFINPPLSLL DIFNPSTMKP SVNSQQYQFN  180
NPSPFLTNTN NNNNHFKLFH DPRVSLSLTL ASSIRNSQLS SLVAPVPKTF SQGLTTSMQV  240
PPLQHNYPSF STNTRPYTAI STNPNGLILG MGIETTTCSR STGNDYMKAT SSSDADNYNV  300
VDPGLSRGNS GLLEDLLEES QTLTRAEKIE ENCLVDENEA SQGKLVWEEY GLTEESTYSF  360
AHGGDDTTPN SSSGITTKDA SLELANQVDD DIMRFLDNFP VAVPAPDWCD DENEQNNTCN  420
GHYFEPRDQM D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-22251185107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1984987e-94AF198498.1 Nicotiana tabacum anther-specific myb-related protein 2 (mybAS2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601500.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLQ9FR420.0Q9FR42_TOBAC; Anther-specific myb-related protein 1
STRINGPGSC0003DMT4000360860.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.12e-61myb domain protein 101